PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 712aa    MW: 79748.3 Da    PI: 5.3005
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906636.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox45.31.4e-14570621556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++f +  ++ L + F++n+yps+e++e+LA +lg+t rq+  WF N R  ++
  XP_010906636.1 570 RRFDPVVTQKLHDSFKENQYPSRETKERLAIELGMTSRQIGKWFENARHSMR 621
                     57899999****************************************8876 PP

2PHD41.14.1e-14170225151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++     +++++lCdg C++ fH+kCl+++l se++p+g   wlC+ C++k
  XP_010906636.1 170 FCAKCSSkdLSVDNDIILCDGaCDRGFHQKCLDPPLLSENIPSGdeGWLCPACDCK 225
                     6999*9955445********66*********************9*9*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579034.65E-14160228IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.109.1E-13164225IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.119168225IPR019787Zinc finger, PHD-finger
SMARTSM002494.9E-10170223IPR001965Zinc finger, PHD-type
PfamPF006281.7E-11170225IPR019787Zinc finger, PHD-finger
CDDcd155047.20E-29170222No hitNo description
PROSITE patternPS013590171222IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.847563623IPR001356Homeobox domain
SMARTSM003896.4E-13566627IPR001356Homeobox domain
SuperFamilySSF466896.42E-13569628IPR009057Homeodomain-like
CDDcd000868.02E-13569621No hitNo description
PfamPF000466.4E-12571621IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-14571628IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MKHGAKKNSK RTLQKGKKAS QSLRGKRYFL RSSLDGVRVL RSMSKGKSKT PAESVTPPVN  60
PTTKRRKRRG KVKGASKDEF SLTRKRVRYL LTRINYEQSL IDAYSSEGWK GQSLEKLRPE  120
KELERAKSEI LRCKLKIRDS FRCLDSLLSA GRLQESLFDS DGQICSEDIF CAKCSSKDLS  180
VDNDIILCDG ACDRGFHQKC LDPPLLSENI PSGDEGWLCP ACDCKVDCID LLSEFQGSSD  240
LSIEDSWEKV FPEAAAIANS DKQYDLSNLP SDDSEDDNYD PDVLEVDTED HMEESSSEED  300
HEEQSSSEES YFTYSSEDSG PSEKRKHYED IGLSSDDSED DDYDPEGPDP DKEIQKESSG  360
SDESDFTSDS DDFCAELSKS GGTDEVSASS LPNLKPLEPS GEGERVSDRN ENATNSEQPS  420
MLEPDPSQKN ALPVSGKRQR DRLDYKKLYD ETYGKASSDS SDDEDWSDKN ALKKGKKDDH  480
VEETDVLKAR SKSTENYRSS GRAKRKATVE NIVTKSDLVQ KQVLLATSED TPKKAYQQKL  540
QSASLHHTQK HDDPWEPDSN GDGATTSVQR RFDPVVTQKL HDSFKENQYP SRETKERLAI  600
ELGMTSRQIG KWFENARHSM RVSAKEANHA VVSTPEEGTS STKAKGNNDK PDKGGVRNYA  660
SNGSKGKKSV GERNDEVGAG RDTSSGEKRK DTQENNRKKA IERELRKRRK SR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1687709KRKDTQENNRKKAIERELRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906632.10.0PREDICTED: homeobox protein HOX1A isoform X2
RefseqXP_010906633.10.0PREDICTED: homeobox protein HOX1A isoform X2
SwissprotP466051e-178HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLK3Z4970.0K3Z497_SETIT; Uncharacterized protein
STRINGSi021365m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-75Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain